Anti PHB2 pAb (ATL-HPA039874)

Atlas Antibodies

Catalog No.: ATL-HPA039874-100

Protein Description: prohibitin 2
Gene Name: PHB2
Alternative Gene Name: Bap37, BCAP37, p22, REA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004264: 100%, ENSRNOG00000012999: 100%
Entrez Gene ID: 11331
Uniprot ID: Q99623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
• Gene Sequence: AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
• Gene ID - Mouse: ENSMUSG00000004264
• Gene ID - Rat: ENSRNOG00000012999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PHB2 pAb (ATL-HPA039874) – 1 Found

Chojnacka, Katarzyna Justyna; Elancheliyan, Praveenraj; Mussulini, Ben Hur Marins; Mohanraj, Karthik; Callegari, Sylvie; Gosk, Aleksandra; Banach, Tomasz; Góral, Tomasz; Szczepanowska, Karolina; Rehling, Peter; Serwa, Remigiusz Adam; Chacinska, Agnieszka. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria. Molecular Biology Of The Cell. 2022;33(4):ar29.