Anti PHB2 pAb (ATL-HPA039874)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039874-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: PHB2
Alternative Gene Name: Bap37, BCAP37, p22, REA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004264: 100%, ENSRNOG00000012999: 100%
Entrez Gene ID: 11331
Uniprot ID: Q99623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
| Gene Sequence | AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK |
| Gene ID - Mouse | ENSMUSG00000004264 |
| Gene ID - Rat | ENSRNOG00000012999 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHB2 pAb (ATL-HPA039874) | |
| Datasheet | Anti PHB2 pAb (ATL-HPA039874) Datasheet (External Link) |
| Vendor Page | Anti PHB2 pAb (ATL-HPA039874) at Atlas Antibodies |
| Documents & Links for Anti PHB2 pAb (ATL-HPA039874) | |
| Datasheet | Anti PHB2 pAb (ATL-HPA039874) Datasheet (External Link) |
| Vendor Page | Anti PHB2 pAb (ATL-HPA039874) |
| Citations for Anti PHB2 pAb (ATL-HPA039874) – 1 Found |
| Chojnacka, Katarzyna Justyna; Elancheliyan, Praveenraj; Mussulini, Ben Hur Marins; Mohanraj, Karthik; Callegari, Sylvie; Gosk, Aleksandra; Banach, Tomasz; Góral, Tomasz; Szczepanowska, Karolina; Rehling, Peter; Serwa, Remigiusz Adam; Chacinska, Agnieszka. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria. Molecular Biology Of The Cell. 2022;33(4):ar29. PubMed |