Anti PHB2 pAb (ATL-HPA039874)

Atlas Antibodies

Catalog No.:
ATL-HPA039874-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: prohibitin 2
Gene Name: PHB2
Alternative Gene Name: Bap37, BCAP37, p22, REA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004264: 100%, ENSRNOG00000012999: 100%
Entrez Gene ID: 11331
Uniprot ID: Q99623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Gene Sequence AQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Gene ID - Mouse ENSMUSG00000004264
Gene ID - Rat ENSRNOG00000012999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHB2 pAb (ATL-HPA039874)
Datasheet Anti PHB2 pAb (ATL-HPA039874) Datasheet (External Link)
Vendor Page Anti PHB2 pAb (ATL-HPA039874) at Atlas Antibodies

Documents & Links for Anti PHB2 pAb (ATL-HPA039874)
Datasheet Anti PHB2 pAb (ATL-HPA039874) Datasheet (External Link)
Vendor Page Anti PHB2 pAb (ATL-HPA039874)
Citations for Anti PHB2 pAb (ATL-HPA039874) – 1 Found
Chojnacka, Katarzyna Justyna; Elancheliyan, Praveenraj; Mussulini, Ben Hur Marins; Mohanraj, Karthik; Callegari, Sylvie; Gosk, Aleksandra; Banach, Tomasz; Góral, Tomasz; Szczepanowska, Karolina; Rehling, Peter; Serwa, Remigiusz Adam; Chacinska, Agnieszka. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria. Molecular Biology Of The Cell. 2022;33(4):ar29.  PubMed