Anti PHAX pAb (ATL-HPA070326 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA070326-25

• 
• 

Protein Description: phosphorylated adaptor for RNA export
Gene Name: PHAX
Alternative Gene Name: FLJ13193, RNUXA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008301: 86%, ENSRNOG00000014459: 87%
Entrez Gene ID: 51808
Uniprot ID: Q9H814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
• Gene Sequence: ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
• Gene ID - Mouse: ENSMUSG00000008301
• Gene ID - Rat: ENSRNOG00000014459
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.