Anti PHAX pAb (ATL-HPA070326 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA070326-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phosphorylated adaptor for RNA export
Gene Name: PHAX
Alternative Gene Name: FLJ13193, RNUXA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008301: 86%, ENSRNOG00000014459: 87%
Entrez Gene ID: 51808
Uniprot ID: Q9H814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
Gene Sequence ESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISFRLQEPKKDLI
Gene ID - Mouse ENSMUSG00000008301
Gene ID - Rat ENSRNOG00000014459
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHAX pAb (ATL-HPA070326 w/enhanced validation)
Datasheet Anti PHAX pAb (ATL-HPA070326 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHAX pAb (ATL-HPA070326 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PHAX pAb (ATL-HPA070326 w/enhanced validation)
Datasheet Anti PHAX pAb (ATL-HPA070326 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PHAX pAb (ATL-HPA070326 w/enhanced validation)