Anti PHAX pAb (ATL-HPA059630)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059630-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: PHAX
Alternative Gene Name: FLJ13193, RNUXA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008301: 72%, ENSRNOG00000014459: 69%
Entrez Gene ID: 51808
Uniprot ID: Q9H814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKC |
Gene Sequence | SDSDMTVAPSDRPLQLPKVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKC |
Gene ID - Mouse | ENSMUSG00000008301 |
Gene ID - Rat | ENSRNOG00000014459 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PHAX pAb (ATL-HPA059630) | |
Datasheet | Anti PHAX pAb (ATL-HPA059630) Datasheet (External Link) |
Vendor Page | Anti PHAX pAb (ATL-HPA059630) at Atlas Antibodies |
Documents & Links for Anti PHAX pAb (ATL-HPA059630) | |
Datasheet | Anti PHAX pAb (ATL-HPA059630) Datasheet (External Link) |
Vendor Page | Anti PHAX pAb (ATL-HPA059630) |