Anti PGRMC2 pAb (ATL-HPA058652 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA058652-25

• 
• 

Protein Description: progesterone receptor membrane component 2
Gene Name: PGRMC2
Alternative Gene Name: DG6, PMBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049940: 98%, ENSRNOG00000014051: 98%
Entrez Gene ID: 10424
Uniprot ID: O15173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
• Gene Sequence: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
• Gene ID - Mouse: ENSMUSG00000049940
• Gene ID - Rat: ENSRNOG00000014051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.