Anti PGRMC1 pAb (ATL-HPA064724)

Atlas Antibodies

Catalog No.:
ATL-HPA064724-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: progesterone receptor membrane component 1
Gene Name: PGRMC1
Alternative Gene Name: HPR6.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006373: 91%, ENSRNOG00000012786: 89%
Entrez Gene ID: 10857
Uniprot ID: O00264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
Gene Sequence SDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
Gene ID - Mouse ENSMUSG00000006373
Gene ID - Rat ENSRNOG00000012786
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGRMC1 pAb (ATL-HPA064724)
Datasheet Anti PGRMC1 pAb (ATL-HPA064724) Datasheet (External Link)
Vendor Page Anti PGRMC1 pAb (ATL-HPA064724) at Atlas Antibodies

Documents & Links for Anti PGRMC1 pAb (ATL-HPA064724)
Datasheet Anti PGRMC1 pAb (ATL-HPA064724) Datasheet (External Link)
Vendor Page Anti PGRMC1 pAb (ATL-HPA064724)