Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA067102-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphoglucomutase 5
Gene Name: PGM5
Alternative Gene Name: PGMRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041731: 94%, ENSRNOG00000015406: 89%
Entrez Gene ID: 5239
Uniprot ID: Q15124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KDGLWAVLVWLSIIAARKQSVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDS
Gene Sequence KDGLWAVLVWLSIIAARKQSVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDS
Gene ID - Mouse ENSMUSG00000041731
Gene ID - Rat ENSRNOG00000015406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation)
Datasheet Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation)
Datasheet Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGM5 pAb (ATL-HPA067102 w/enhanced validation)