Anti PGM2L1 pAb (ATL-HPA060948)

Atlas Antibodies

Catalog No.:
ATL-HPA060948-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphoglucomutase 2-like 1
Gene Name: PGM2L1
Alternative Gene Name: BM32A, FLJ32029
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030729: 100%, ENSRNOG00000017079: 100%
Entrez Gene ID: 283209
Uniprot ID: Q6PCE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV
Gene Sequence GLRSAMGAGFCYINDLTVIQSTQGMYKYLERCFSDFKQRGFVVGYDTRGQVTSSCSSQRLAKLTAAV
Gene ID - Mouse ENSMUSG00000030729
Gene ID - Rat ENSRNOG00000017079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGM2L1 pAb (ATL-HPA060948)
Datasheet Anti PGM2L1 pAb (ATL-HPA060948) Datasheet (External Link)
Vendor Page Anti PGM2L1 pAb (ATL-HPA060948) at Atlas Antibodies

Documents & Links for Anti PGM2L1 pAb (ATL-HPA060948)
Datasheet Anti PGM2L1 pAb (ATL-HPA060948) Datasheet (External Link)
Vendor Page Anti PGM2L1 pAb (ATL-HPA060948)