Anti PGLYRP2 pAb (ATL-HPA075237)

Atlas Antibodies

Catalog No.: ATL-HPA075237-25

Protein Description: peptidoglycan recognition protein 2
Gene Name: PGLYRP2
Alternative Gene Name: PGLYRPL, PGRP-L, PGRPL, tagL, tagL-alpha, tagl-beta, TAGL-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079563: 52%, ENSRNOG00000028198: 31%
Entrez Gene ID: 114770
Uniprot ID: Q96PD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDL
• Gene Sequence: DTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHFTATVKPRPARSVSKRSRREPPPRTLPATDL
• Gene ID - Mouse: ENSMUSG00000079563
• Gene ID - Rat: ENSRNOG00000028198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.