Anti PGLYRP1 pAb (ATL-HPA070227)

Atlas Antibodies

SKU: ATL-HPA070227-25

• 

Protein Description: peptidoglycan recognition protein 1
Gene Name: PGLYRP1
Alternative Gene Name: PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030413: 72%, ENSRNOG00000013395: 72%
Entrez Gene ID: 8993
Uniprot ID: O75594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF
• Gene Sequence: VPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNF
• Gene ID - Mouse: ENSMUSG00000030413
• Gene ID - Rat: ENSRNOG00000013395
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.