Anti PGK1 pAb (ATL-HPA045385)

Atlas Antibodies

Catalog No.:
ATL-HPA045385-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: phosphoglycerate kinase 1
Gene Name: PGK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062070: 97%, ENSRNOG00000058249: 97%
Entrez Gene ID: 5230
Uniprot ID: P00558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
Gene Sequence IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
Gene ID - Mouse ENSMUSG00000062070
Gene ID - Rat ENSRNOG00000058249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGK1 pAb (ATL-HPA045385)
Datasheet Anti PGK1 pAb (ATL-HPA045385) Datasheet (External Link)
Vendor Page Anti PGK1 pAb (ATL-HPA045385) at Atlas Antibodies

Documents & Links for Anti PGK1 pAb (ATL-HPA045385)
Datasheet Anti PGK1 pAb (ATL-HPA045385) Datasheet (External Link)
Vendor Page Anti PGK1 pAb (ATL-HPA045385)