Anti PGAP1 pAb (ATL-HPA069704)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069704-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PGAP1
Alternative Gene Name: Bst1, FLJ12377, SPG67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%
Entrez Gene ID: 80055
Uniprot ID: Q75T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST |
| Gene Sequence | HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST |
| Gene ID - Mouse | ENSMUSG00000073678 |
| Gene ID - Rat | ENSRNOG00000013388 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PGAP1 pAb (ATL-HPA069704) | |
| Datasheet | Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link) |
| Vendor Page | Anti PGAP1 pAb (ATL-HPA069704) at Atlas Antibodies |
| Documents & Links for Anti PGAP1 pAb (ATL-HPA069704) | |
| Datasheet | Anti PGAP1 pAb (ATL-HPA069704) Datasheet (External Link) |
| Vendor Page | Anti PGAP1 pAb (ATL-HPA069704) |