Anti PGAP1 pAb (ATL-HPA069704)

Atlas Antibodies

Catalog No.: ATL-HPA069704-25

Protein Description: post-GPI attachment to proteins 1
Gene Name: PGAP1
Alternative Gene Name: Bst1, FLJ12377, SPG67
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073678: 89%, ENSRNOG00000013388: 91%
Entrez Gene ID: 80055
Uniprot ID: Q75T13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST
• Gene Sequence: HLQASLTTFKNSQPVNPKHSRRSEKKSNHHKDSSIHHLRLSANDAEDSLRMHST
• Gene ID - Mouse: ENSMUSG00000073678
• Gene ID - Rat: ENSRNOG00000013388
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.