Anti PFKP pAb (ATL-HPA056484)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056484-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PFKP
Alternative Gene Name: PFK-C, PFKF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021196: 85%, ENSRNOG00000017163: 87%
Entrez Gene ID: 5214
Uniprot ID: Q01813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV |
Gene Sequence | MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV |
Gene ID - Mouse | ENSMUSG00000021196 |
Gene ID - Rat | ENSRNOG00000017163 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PFKP pAb (ATL-HPA056484) | |
Datasheet | Anti PFKP pAb (ATL-HPA056484) Datasheet (External Link) |
Vendor Page | Anti PFKP pAb (ATL-HPA056484) at Atlas Antibodies |
Documents & Links for Anti PFKP pAb (ATL-HPA056484) | |
Datasheet | Anti PFKP pAb (ATL-HPA056484) Datasheet (External Link) |
Vendor Page | Anti PFKP pAb (ATL-HPA056484) |