Anti PFKP pAb (ATL-HPA056484)

Atlas Antibodies

Catalog No.:
ATL-HPA056484-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: phosphofructokinase, platelet
Gene Name: PFKP
Alternative Gene Name: PFK-C, PFKF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021196: 85%, ENSRNOG00000017163: 87%
Entrez Gene ID: 5214
Uniprot ID: Q01813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV
Gene Sequence MECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINV
Gene ID - Mouse ENSMUSG00000021196
Gene ID - Rat ENSRNOG00000017163
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFKP pAb (ATL-HPA056484)
Datasheet Anti PFKP pAb (ATL-HPA056484) Datasheet (External Link)
Vendor Page Anti PFKP pAb (ATL-HPA056484) at Atlas Antibodies

Documents & Links for Anti PFKP pAb (ATL-HPA056484)
Datasheet Anti PFKP pAb (ATL-HPA056484) Datasheet (External Link)
Vendor Page Anti PFKP pAb (ATL-HPA056484)