Anti PFKM pAb (ATL-HPA002117)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002117-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PFKM
Alternative Gene Name: PFK-1, PFKX, PPP1R122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033065: 95%, ENSRNOG00000057988: 95%
Entrez Gene ID: 5213
Uniprot ID: P08237
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA |
| Gene Sequence | CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA |
| Gene ID - Mouse | ENSMUSG00000033065 |
| Gene ID - Rat | ENSRNOG00000057988 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PFKM pAb (ATL-HPA002117) | |
| Datasheet | Anti PFKM pAb (ATL-HPA002117) Datasheet (External Link) |
| Vendor Page | Anti PFKM pAb (ATL-HPA002117) at Atlas Antibodies |
| Documents & Links for Anti PFKM pAb (ATL-HPA002117) | |
| Datasheet | Anti PFKM pAb (ATL-HPA002117) Datasheet (External Link) |
| Vendor Page | Anti PFKM pAb (ATL-HPA002117) |
| Citations for Anti PFKM pAb (ATL-HPA002117) – 1 Found |
| Kim, Nam Hee; Cha, Yong Hoon; Lee, Jueun; Lee, Seon-Hyeong; Yang, Ji Hye; Yun, Jun Seop; Cho, Eunae Sandra; Zhang, Xianglan; Nam, Miso; Kim, Nami; Yuk, Young-Su; Cha, So Young; Lee, Yoonmi; Ryu, Joo Kyung; Park, Sunghyouk; Cheong, Jae-Ho; Kang, Sang Won; Kim, Soo-Youl; Hwang, Geum-Sook; Yook, Jong In; Kim, Hyun Sil. Snail reprograms glucose metabolism by repressing phosphofructokinase PFKP allowing cancer cell survival under metabolic stress. Nature Communications. 2017;8( 28176759):14374. PubMed |