Anti PFKFB4 pAb (ATL-HPA047719)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047719-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PFKFB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025648: 97%, ENSRNOG00000020656: 97%
Entrez Gene ID: 5210
Uniprot ID: Q16877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI |
Gene Sequence | RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI |
Gene ID - Mouse | ENSMUSG00000025648 |
Gene ID - Rat | ENSRNOG00000020656 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PFKFB4 pAb (ATL-HPA047719) | |
Datasheet | Anti PFKFB4 pAb (ATL-HPA047719) Datasheet (External Link) |
Vendor Page | Anti PFKFB4 pAb (ATL-HPA047719) at Atlas Antibodies |
Documents & Links for Anti PFKFB4 pAb (ATL-HPA047719) | |
Datasheet | Anti PFKFB4 pAb (ATL-HPA047719) Datasheet (External Link) |
Vendor Page | Anti PFKFB4 pAb (ATL-HPA047719) |