Anti PFKFB4 pAb (ATL-HPA047719)

Atlas Antibodies

Catalog No.:
ATL-HPA047719-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4
Gene Name: PFKFB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025648: 97%, ENSRNOG00000020656: 97%
Entrez Gene ID: 5210
Uniprot ID: Q16877
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Gene Sequence RELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLI
Gene ID - Mouse ENSMUSG00000025648
Gene ID - Rat ENSRNOG00000020656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFKFB4 pAb (ATL-HPA047719)
Datasheet Anti PFKFB4 pAb (ATL-HPA047719) Datasheet (External Link)
Vendor Page Anti PFKFB4 pAb (ATL-HPA047719) at Atlas Antibodies

Documents & Links for Anti PFKFB4 pAb (ATL-HPA047719)
Datasheet Anti PFKFB4 pAb (ATL-HPA047719) Datasheet (External Link)
Vendor Page Anti PFKFB4 pAb (ATL-HPA047719)