Anti PFKFB3 pAb (ATL-HPA043889)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043889-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PFKFB3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026773: 96%, ENSRNOG00000018911: 98%
Entrez Gene ID: 5209
Uniprot ID: Q16875
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV |
Gene Sequence | YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV |
Gene ID - Mouse | ENSMUSG00000026773 |
Gene ID - Rat | ENSRNOG00000018911 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PFKFB3 pAb (ATL-HPA043889) | |
Datasheet | Anti PFKFB3 pAb (ATL-HPA043889) Datasheet (External Link) |
Vendor Page | Anti PFKFB3 pAb (ATL-HPA043889) at Atlas Antibodies |
Documents & Links for Anti PFKFB3 pAb (ATL-HPA043889) | |
Datasheet | Anti PFKFB3 pAb (ATL-HPA043889) Datasheet (External Link) |
Vendor Page | Anti PFKFB3 pAb (ATL-HPA043889) |