Anti PFKFB3 pAb (ATL-HPA043889)

Atlas Antibodies

Catalog No.:
ATL-HPA043889-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Gene Name: PFKFB3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026773: 96%, ENSRNOG00000018911: 98%
Entrez Gene ID: 5209
Uniprot ID: Q16875
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV
Gene Sequence YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV
Gene ID - Mouse ENSMUSG00000026773
Gene ID - Rat ENSRNOG00000018911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFKFB3 pAb (ATL-HPA043889)
Datasheet Anti PFKFB3 pAb (ATL-HPA043889) Datasheet (External Link)
Vendor Page Anti PFKFB3 pAb (ATL-HPA043889) at Atlas Antibodies

Documents & Links for Anti PFKFB3 pAb (ATL-HPA043889)
Datasheet Anti PFKFB3 pAb (ATL-HPA043889) Datasheet (External Link)
Vendor Page Anti PFKFB3 pAb (ATL-HPA043889)