Anti PFKFB2 pAb (ATL-HPA049975)

Atlas Antibodies

SKU:
ATL-HPA049975-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in astrocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Gene Name: PFKFB2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026409: 95%, ENSRNOG00000004162: 95%
Entrez Gene ID: 5208
Uniprot ID: O60825
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Gene Sequence RDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEG
Gene ID - Mouse ENSMUSG00000026409
Gene ID - Rat ENSRNOG00000004162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PFKFB2 pAb (ATL-HPA049975)
Datasheet Anti PFKFB2 pAb (ATL-HPA049975) Datasheet (External Link)
Vendor Page Anti PFKFB2 pAb (ATL-HPA049975) at Atlas Antibodies

Documents & Links for Anti PFKFB2 pAb (ATL-HPA049975)
Datasheet Anti PFKFB2 pAb (ATL-HPA049975) Datasheet (External Link)
Vendor Page Anti PFKFB2 pAb (ATL-HPA049975)