Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043032-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: prefoldin subunit 6
Gene Name: PFDN6
Alternative Gene Name: H2-KE2, HKE2, KE-2, PFD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024309: 100%, ENSRNOG00000000473: 100%
Entrez Gene ID: 10471
Uniprot ID: O15212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG
Gene Sequence KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG
Gene ID - Mouse ENSMUSG00000024309
Gene ID - Rat ENSRNOG00000000473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation)
Datasheet Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation)
Datasheet Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PFDN6 pAb (ATL-HPA043032 w/enhanced validation)