Anti PFDN5 pAb (ATL-HPA008587)

Atlas Antibodies

Catalog No.:
ATL-HPA008587-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: prefoldin subunit 5
Gene Name: PFDN5
Alternative Gene Name: MM-1, PFD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001289: 100%, ENSRNOG00000012985: 99%
Entrez Gene ID: 5204
Uniprot ID: Q99471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Gene Sequence INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Gene ID - Mouse ENSMUSG00000001289
Gene ID - Rat ENSRNOG00000012985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFDN5 pAb (ATL-HPA008587)
Datasheet Anti PFDN5 pAb (ATL-HPA008587) Datasheet (External Link)
Vendor Page Anti PFDN5 pAb (ATL-HPA008587) at Atlas Antibodies

Documents & Links for Anti PFDN5 pAb (ATL-HPA008587)
Datasheet Anti PFDN5 pAb (ATL-HPA008587) Datasheet (External Link)
Vendor Page Anti PFDN5 pAb (ATL-HPA008587)
Citations for Anti PFDN5 pAb (ATL-HPA008587) – 1 Found
Rogers, Scott W; Gahring, Lorise C. Upregulation of Nicotinic Acetylcholine Receptor alph4+beta2 through a Ligand-Independent PI3Kbeta Mechanism That Is Enhanced by TNFalpha and the Jak2/p38Mapk Pathways. Plos One. 10(11):e0143319.  PubMed