Anti PFDN2 pAb (ATL-HPA028700)

Atlas Antibodies

Catalog No.:
ATL-HPA028700-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: prefoldin subunit 2
Gene Name: PFDN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006412: 95%, ENSRNOG00000003983: 93%
Entrez Gene ID: 5202
Uniprot ID: Q9UHV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVG
Gene Sequence MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVG
Gene ID - Mouse ENSMUSG00000006412
Gene ID - Rat ENSRNOG00000003983
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PFDN2 pAb (ATL-HPA028700)
Datasheet Anti PFDN2 pAb (ATL-HPA028700) Datasheet (External Link)
Vendor Page Anti PFDN2 pAb (ATL-HPA028700) at Atlas Antibodies

Documents & Links for Anti PFDN2 pAb (ATL-HPA028700)
Datasheet Anti PFDN2 pAb (ATL-HPA028700) Datasheet (External Link)
Vendor Page Anti PFDN2 pAb (ATL-HPA028700)