Anti PFAS pAb (ATL-HPA022886 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022886-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: PFAS
Alternative Gene Name: FGARAT, KIAA0361, PURL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020899: 95%, ENSRNOG00000005193: 96%
Entrez Gene ID: 5198
Uniprot ID: O15067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSG |
| Gene Sequence | ALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGPLQTPLADVAVVALSHEELIGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLRDVKCSG |
| Gene ID - Mouse | ENSMUSG00000020899 |
| Gene ID - Rat | ENSRNOG00000005193 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) | |
| Datasheet | Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) | |
| Datasheet | Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) |
| Citations for Anti PFAS pAb (ATL-HPA022886 w/enhanced validation) – 1 Found |
| Lv, Yajing; Wang, Xiaoshuang; Li, Xiaoyu; Xu, Guangwei; Bai, Yuting; Wu, Jiayi; Piao, Yongjun; Shi, Yi; Xiang, Rong; Wang, Longlong. Nucleotide de novo synthesis increases breast cancer stemness and metastasis via cGMP-PKG-MAPK signaling pathway. Plos Biology. 2020;18(11):e3000872. PubMed |