Anti PEX7 pAb (ATL-HPA049202)

Atlas Antibodies

Catalog No.: ATL-HPA049202-25

Protein Description: peroxisomal biogenesis factor 7
Gene Name: PEX7
Alternative Gene Name: PTS2R, RD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020003: 81%, ENSRNOG00000012322: 80%
Entrez Gene ID: 5191
Uniprot ID: O00628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
• Gene Sequence: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
• Gene ID - Mouse: ENSMUSG00000020003
• Gene ID - Rat: ENSRNOG00000012322
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.