Anti PEX7 pAb (ATL-HPA049202)

Atlas Antibodies

Catalog No.:
ATL-HPA049202-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 7
Gene Name: PEX7
Alternative Gene Name: PTS2R, RD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020003: 81%, ENSRNOG00000012322: 80%
Entrez Gene ID: 5191
Uniprot ID: O00628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
Gene Sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGD
Gene ID - Mouse ENSMUSG00000020003
Gene ID - Rat ENSRNOG00000012322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX7 pAb (ATL-HPA049202)
Datasheet Anti PEX7 pAb (ATL-HPA049202) Datasheet (External Link)
Vendor Page Anti PEX7 pAb (ATL-HPA049202) at Atlas Antibodies

Documents & Links for Anti PEX7 pAb (ATL-HPA049202)
Datasheet Anti PEX7 pAb (ATL-HPA049202) Datasheet (External Link)
Vendor Page Anti PEX7 pAb (ATL-HPA049202)