Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025924-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PEX6
Alternative Gene Name: PAF-2, PXAAA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002763: 88%, ENSRNOG00000016655: 86%
Entrez Gene ID: 5190
Uniprot ID: Q13608
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSS |
| Gene Sequence | GAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSS |
| Gene ID - Mouse | ENSMUSG00000002763 |
| Gene ID - Rat | ENSRNOG00000016655 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) | |
| Datasheet | Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) | |
| Datasheet | Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) |
| Citations for Anti PEX6 pAb (ATL-HPA025924 w/enhanced validation) – 1 Found |
| Falkenberg, Kim D; Braverman, Nancy E; Moser, Ann B; Steinberg, Steven J; Klouwer, Femke C C; Schlüter, Agatha; Ruiz, Montserrat; Pujol, Aurora; Engvall, Martin; Naess, Karin; van Spronsen, FrancJan; Körver-Keularts, Irene; Rubio-Gozalbo, M Estela; Ferdinandusse, Sacha; Wanders, Ronald J A; Waterham, Hans R. Allelic Expression Imbalance Promoting a Mutant PEX6 Allele Causes Zellweger Spectrum Disorder. American Journal Of Human Genetics. 2017;101(6):965-976. PubMed |