Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058006-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and PEX3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401203).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 3
Gene Name: PEX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019809: 84%, ENSRNOG00000015660: 86%
Entrez Gene ID: 8504
Uniprot ID: P56589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
Gene Sequence SLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMPDEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLN
Gene ID - Mouse ENSMUSG00000019809
Gene ID - Rat ENSRNOG00000015660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation)
Datasheet Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation)
Datasheet Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEX3 pAb (ATL-HPA058006 w/enhanced validation)