Anti PEX19 pAb (ATL-HPA044837)

Atlas Antibodies

Catalog No.:
ATL-HPA044837-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 19
Gene Name: PEX19
Alternative Gene Name: D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003464: 89%, ENSRNOG00000057116: 92%
Entrez Gene ID: 5824
Uniprot ID: P40855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP
Gene Sequence SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP
Gene ID - Mouse ENSMUSG00000003464
Gene ID - Rat ENSRNOG00000057116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX19 pAb (ATL-HPA044837)
Datasheet Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link)
Vendor Page Anti PEX19 pAb (ATL-HPA044837) at Atlas Antibodies

Documents & Links for Anti PEX19 pAb (ATL-HPA044837)
Datasheet Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link)
Vendor Page Anti PEX19 pAb (ATL-HPA044837)