Anti PEX19 pAb (ATL-HPA044837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044837-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PEX19
Alternative Gene Name: D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003464: 89%, ENSRNOG00000057116: 92%
Entrez Gene ID: 5824
Uniprot ID: P40855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP |
| Gene Sequence | SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP |
| Gene ID - Mouse | ENSMUSG00000003464 |
| Gene ID - Rat | ENSRNOG00000057116 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PEX19 pAb (ATL-HPA044837) | |
| Datasheet | Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link) |
| Vendor Page | Anti PEX19 pAb (ATL-HPA044837) at Atlas Antibodies |
| Documents & Links for Anti PEX19 pAb (ATL-HPA044837) | |
| Datasheet | Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link) |
| Vendor Page | Anti PEX19 pAb (ATL-HPA044837) |