Anti PEX19 pAb (ATL-HPA044837)

Atlas Antibodies

Catalog No.: ATL-HPA044837-25

Protein Description: peroxisomal biogenesis factor 19
Gene Name: PEX19
Alternative Gene Name: D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003464: 89%, ENSRNOG00000057116: 92%
Entrez Gene ID: 5824
Uniprot ID: P40855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP
• Gene Sequence: SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP
• Gene ID - Mouse: ENSMUSG00000003464
• Gene ID - Rat: ENSRNOG00000057116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.