Anti PEX19 pAb (ATL-HPA044837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044837-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PEX19
Alternative Gene Name: D1S2223E, HK33, PMP1, PMPI, PXF, PXMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003464: 89%, ENSRNOG00000057116: 92%
Entrez Gene ID: 5824
Uniprot ID: P40855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP |
Gene Sequence | SSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLP |
Gene ID - Mouse | ENSMUSG00000003464 |
Gene ID - Rat | ENSRNOG00000057116 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PEX19 pAb (ATL-HPA044837) | |
Datasheet | Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link) |
Vendor Page | Anti PEX19 pAb (ATL-HPA044837) at Atlas Antibodies |
Documents & Links for Anti PEX19 pAb (ATL-HPA044837) | |
Datasheet | Anti PEX19 pAb (ATL-HPA044837) Datasheet (External Link) |
Vendor Page | Anti PEX19 pAb (ATL-HPA044837) |