Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069386-25
  • Immunohistochemistry analysis in human epididymis and bone marrow tissues using Anti-PEX12 antibody. Corresponding PEX12 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 12
Gene Name: PEX12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018733: 65%, ENSRNOG00000052864: 69%
Entrez Gene ID: 5193
Uniprot ID: O00623
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSAL
Gene Sequence KAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSAL
Gene ID - Mouse ENSMUSG00000018733
Gene ID - Rat ENSRNOG00000052864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation)
Datasheet Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation)
Datasheet Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PEX12 pAb (ATL-HPA069386 w/enhanced validation)