Anti PEX10 pAb (ATL-HPA049458)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049458-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PEX10
Alternative Gene Name: RNF69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050761: 36%, ENSRNOG00000046157: 38%
Entrez Gene ID: 5192
Uniprot ID: O60683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR |
Gene Sequence | GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR |
Gene ID - Mouse | ENSMUSG00000050761 |
Gene ID - Rat | ENSRNOG00000046157 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PEX10 pAb (ATL-HPA049458) | |
Datasheet | Anti PEX10 pAb (ATL-HPA049458) Datasheet (External Link) |
Vendor Page | Anti PEX10 pAb (ATL-HPA049458) at Atlas Antibodies |
Documents & Links for Anti PEX10 pAb (ATL-HPA049458) | |
Datasheet | Anti PEX10 pAb (ATL-HPA049458) Datasheet (External Link) |
Vendor Page | Anti PEX10 pAb (ATL-HPA049458) |