Anti PEX10 pAb (ATL-HPA049458)

Atlas Antibodies

Catalog No.:
ATL-HPA049458-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 10
Gene Name: PEX10
Alternative Gene Name: RNF69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050761: 36%, ENSRNOG00000046157: 38%
Entrez Gene ID: 5192
Uniprot ID: O60683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR
Gene Sequence GITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYR
Gene ID - Mouse ENSMUSG00000050761
Gene ID - Rat ENSRNOG00000046157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX10 pAb (ATL-HPA049458)
Datasheet Anti PEX10 pAb (ATL-HPA049458) Datasheet (External Link)
Vendor Page Anti PEX10 pAb (ATL-HPA049458) at Atlas Antibodies

Documents & Links for Anti PEX10 pAb (ATL-HPA049458)
Datasheet Anti PEX10 pAb (ATL-HPA049458) Datasheet (External Link)
Vendor Page Anti PEX10 pAb (ATL-HPA049458)