Anti PES1 pAb (ATL-HPA066670 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA066670-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pescadillo ribosomal biogenesis factor 1
Gene Name: PES1
Alternative Gene Name: PES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020430: 85%, ENSRNOG00000004515: 84%
Entrez Gene ID: 23481
Uniprot ID: O00541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE
Gene Sequence LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE
Gene ID - Mouse ENSMUSG00000020430
Gene ID - Rat ENSRNOG00000004515
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation)
Datasheet Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation)
Datasheet Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PES1 pAb (ATL-HPA066670 w/enhanced validation)
Citations for Anti PES1 pAb (ATL-HPA066670 w/enhanced validation) – 1 Found
Ognibene, Marzia; Pezzolo, Annalisa. Roniciclib down-regulates stemness and inhibits cell growth by inducing nucleolar stress in neuroblastoma. Scientific Reports. 2020;10(1):12902.  PubMed