Anti PES1 pAb (ATL-HPA062439 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062439-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PES1
Alternative Gene Name: PES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020430: 88%, ENSRNOG00000004515: 89%
Entrez Gene ID: 23481
Uniprot ID: O00541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEE |
Gene Sequence | QWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEE |
Gene ID - Mouse | ENSMUSG00000020430 |
Gene ID - Rat | ENSRNOG00000004515 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) | |
Datasheet | Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) | |
Datasheet | Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) |
Citations for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) – 1 Found |
Sun, Yulin; Zheng, Weiwei; Guo, Zhengguang; Ju, Qiang; Zhu, Lin; Gao, Jiajia; Zhou, Lanping; Liu, Fang; Xu, Yang; Zhan, Qimin; Zhou, Zhixiang; Sun, Wei; Zhao, Xiaohang. A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. Scientific Reports. 2016;6( 27312428):28083. PubMed |