Anti PES1 pAb (ATL-HPA062439 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA062439-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pescadillo ribosomal biogenesis factor 1
Gene Name: PES1
Alternative Gene Name: PES
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020430: 88%, ENSRNOG00000004515: 89%
Entrez Gene ID: 23481
Uniprot ID: O00541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEE
Gene Sequence QWVFDSVNARLLLPVAEYFSGVQLPPHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEE
Gene ID - Mouse ENSMUSG00000020430
Gene ID - Rat ENSRNOG00000004515
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation)
Datasheet Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation)
Datasheet Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PES1 pAb (ATL-HPA062439 w/enhanced validation)
Citations for Anti PES1 pAb (ATL-HPA062439 w/enhanced validation) – 1 Found
Sun, Yulin; Zheng, Weiwei; Guo, Zhengguang; Ju, Qiang; Zhu, Lin; Gao, Jiajia; Zhou, Lanping; Liu, Fang; Xu, Yang; Zhan, Qimin; Zhou, Zhixiang; Sun, Wei; Zhao, Xiaohang. A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. Scientific Reports. 2016;6( 27312428):28083.  PubMed