Anti PELP1 pAb (ATL-HPA053966)

Atlas Antibodies

Catalog No.:
ATL-HPA053966-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: proline, glutamate and leucine rich protein 1
Gene Name: PELP1
Alternative Gene Name: MNAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018921: 96%, ENSRNOG00000019268: 94%
Entrez Gene ID: 27043
Uniprot ID: Q8IZL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene Sequence GPPTTANHLGLSVPGLVSVPPRLLPGPENHRAGSNEDPILAPSGTPPPTIPPDETFGGRVPRPAFVHYDKEEASDVEISLESDSDDSVVIVPE
Gene ID - Mouse ENSMUSG00000018921
Gene ID - Rat ENSRNOG00000019268
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PELP1 pAb (ATL-HPA053966)
Datasheet Anti PELP1 pAb (ATL-HPA053966) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA053966) at Atlas Antibodies

Documents & Links for Anti PELP1 pAb (ATL-HPA053966)
Datasheet Anti PELP1 pAb (ATL-HPA053966) Datasheet (External Link)
Vendor Page Anti PELP1 pAb (ATL-HPA053966)