Anti PEBP1 pAb (ATL-HPA063904)

Atlas Antibodies

Catalog No.:
ATL-HPA063904-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: phosphatidylethanolamine binding protein 1
Gene Name: PEBP1
Alternative Gene Name: HCNP, PBP, PEBP, RKIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032959: 72%, ENSRNOG00000008667: 74%
Entrez Gene ID: 5037
Uniprot ID: P30086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP
Gene Sequence MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP
Gene ID - Mouse ENSMUSG00000032959
Gene ID - Rat ENSRNOG00000008667
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEBP1 pAb (ATL-HPA063904)
Datasheet Anti PEBP1 pAb (ATL-HPA063904) Datasheet (External Link)
Vendor Page Anti PEBP1 pAb (ATL-HPA063904) at Atlas Antibodies

Documents & Links for Anti PEBP1 pAb (ATL-HPA063904)
Datasheet Anti PEBP1 pAb (ATL-HPA063904) Datasheet (External Link)
Vendor Page Anti PEBP1 pAb (ATL-HPA063904)
Citations for Anti PEBP1 pAb (ATL-HPA063904) – 1 Found
Wojdała, Anna Lidia; Chiasserini, Davide; Bellomo, Giovanni; Paciotti, Silvia; Gaetani, Lorenzo; Paoletti, Federico Paolini; Parnetti, Lucilla. Phosphatidylethanolamine Binding Protein 1 (PEBP1) in Alzheimer's Disease: ELISA Development and Clinical Validation. Journal Of Alzheimer's Disease : Jad. 88(4):1459-1468.  PubMed