Anti PEBP1 pAb (ATL-HPA063904)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063904-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PEBP1
Alternative Gene Name: HCNP, PBP, PEBP, RKIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032959: 72%, ENSRNOG00000008667: 74%
Entrez Gene ID: 5037
Uniprot ID: P30086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP |
| Gene Sequence | MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTP |
| Gene ID - Mouse | ENSMUSG00000032959 |
| Gene ID - Rat | ENSRNOG00000008667 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PEBP1 pAb (ATL-HPA063904) | |
| Datasheet | Anti PEBP1 pAb (ATL-HPA063904) Datasheet (External Link) |
| Vendor Page | Anti PEBP1 pAb (ATL-HPA063904) at Atlas Antibodies |
| Documents & Links for Anti PEBP1 pAb (ATL-HPA063904) | |
| Datasheet | Anti PEBP1 pAb (ATL-HPA063904) Datasheet (External Link) |
| Vendor Page | Anti PEBP1 pAb (ATL-HPA063904) |
| Citations for Anti PEBP1 pAb (ATL-HPA063904) – 1 Found |
| Wojdała, Anna Lidia; Chiasserini, Davide; Bellomo, Giovanni; Paciotti, Silvia; Gaetani, Lorenzo; Paoletti, Federico Paolini; Parnetti, Lucilla. Phosphatidylethanolamine Binding Protein 1 (PEBP1) in Alzheimer's Disease: ELISA Development and Clinical Validation. Journal Of Alzheimer's Disease : Jad. 88(4):1459-1468. PubMed |