Anti PDZRN3 pAb (ATL-HPA061420)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061420-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDZRN3
Alternative Gene Name: KIAA1095, LNX3, SEMACAP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035357: 94%, ENSRNOG00000057556: 95%
Entrez Gene ID: 23024
Uniprot ID: Q9UPQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR |
Gene Sequence | SEQENNGDDATASSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFR |
Gene ID - Mouse | ENSMUSG00000035357 |
Gene ID - Rat | ENSRNOG00000057556 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDZRN3 pAb (ATL-HPA061420) | |
Datasheet | Anti PDZRN3 pAb (ATL-HPA061420) Datasheet (External Link) |
Vendor Page | Anti PDZRN3 pAb (ATL-HPA061420) at Atlas Antibodies |
Documents & Links for Anti PDZRN3 pAb (ATL-HPA061420) | |
Datasheet | Anti PDZRN3 pAb (ATL-HPA061420) Datasheet (External Link) |
Vendor Page | Anti PDZRN3 pAb (ATL-HPA061420) |