Anti PDZK1IP1 pAb (ATL-HPA014907 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014907-25

Protein Description: PDZK1 interacting protein 1
Gene Name: PDZK1IP1
Alternative Gene Name: DD96, MAP17, SPAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028716: 77%, ENSRNOG00000008161: 74%
Entrez Gene ID: 10158
Uniprot ID: Q13113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST
• Gene Sequence: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST
• Gene ID - Mouse: ENSMUSG00000028716
• Gene ID - Rat: ENSRNOG00000008161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDZK1IP1 pAb (ATL-HPA014907 w/enhanced validation) – 2 Found

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614. 

Zhou, Royce W; Xu, Jia; Martin, Tiphaine C; Zachem, Alexis L; He, John; Ozturk, Sait; Demircioglu, Deniz; Bansal, Ankita; Trotta, Andrew P; Giotti, Bruno; Gryder, Berkley; Shen, Yao; Wu, Xuewei; Carcamo, Saul; Bosch, Kaitlyn; Hopkins, Benjamin; Tsankov, Alexander; Steinhagen, Randolph; Jones, Drew R; Asara, John; Chipuk, Jerry E; Brody, Rachel; Itzkowitz, Steven; Chio, Iok In Christine; Hasson, Dan; Bernstein, Emily; Parsons, Ramon E. A local tumor microenvironment acquired super-enhancer induces an oncogenic driver in colorectal carcinoma. Nature Communications. 2022;13(1):6041.