Anti PDZD7 pAb (ATL-HPA074542)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074542-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PDZD7
Alternative Gene Name: bA108L7.8, DFNB57, FLJ23209, PDZK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074818: 86%, ENSRNOG00000032946: 86%
Entrez Gene ID: 79955
Uniprot ID: Q9H5P4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSQSYLTLWEEKQQRRKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWTLDSGSL |
| Gene Sequence | RSQSYLTLWEEKQQRRKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWTLDSGSL |
| Gene ID - Mouse | ENSMUSG00000074818 |
| Gene ID - Rat | ENSRNOG00000032946 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDZD7 pAb (ATL-HPA074542) | |
| Datasheet | Anti PDZD7 pAb (ATL-HPA074542) Datasheet (External Link) |
| Vendor Page | Anti PDZD7 pAb (ATL-HPA074542) at Atlas Antibodies |
| Documents & Links for Anti PDZD7 pAb (ATL-HPA074542) | |
| Datasheet | Anti PDZD7 pAb (ATL-HPA074542) Datasheet (External Link) |
| Vendor Page | Anti PDZD7 pAb (ATL-HPA074542) |