Anti PDZD7 pAb (ATL-HPA074542)

Atlas Antibodies

SKU: ATL-HPA074542-25

• 

Protein Description: PDZ domain containing 7
Gene Name: PDZD7
Alternative Gene Name: bA108L7.8, DFNB57, FLJ23209, PDZK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074818: 86%, ENSRNOG00000032946: 86%
Entrez Gene ID: 79955
Uniprot ID: Q9H5P4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSQSYLTLWEEKQQRRKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWTLDSGSL
• Gene Sequence: RSQSYLTLWEEKQQRRKEKSGSPGEKGALQRSKTLMNLFFKGGRQGRLARDGRREAWTLDSGSL
• Gene ID - Mouse: ENSMUSG00000074818
• Gene ID - Rat: ENSRNOG00000032946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.