Anti PDZD2 pAb (ATL-HPA076072)

Atlas Antibodies

Catalog No.: ATL-HPA076072-25

Protein Description: PDZ domain containing 2
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 44%, ENSRNOG00000013140: 42%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP
• Gene Sequence: SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP
• Gene ID - Mouse: ENSMUSG00000022197
• Gene ID - Rat: ENSRNOG00000013140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.