Anti PDZD2 pAb (ATL-HPA076072)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076072-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 44%, ENSRNOG00000013140: 42%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP |
| Gene Sequence | SKVARHFHSPPIILSSPNMVNGLEHDLLDDETLNQYETSINAAASLSSFSVDVPKNGESVLENLHISESQDLDDLLQKP |
| Gene ID - Mouse | ENSMUSG00000022197 |
| Gene ID - Rat | ENSRNOG00000013140 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDZD2 pAb (ATL-HPA076072) | |
| Datasheet | Anti PDZD2 pAb (ATL-HPA076072) Datasheet (External Link) |
| Vendor Page | Anti PDZD2 pAb (ATL-HPA076072) at Atlas Antibodies |
| Documents & Links for Anti PDZD2 pAb (ATL-HPA076072) | |
| Datasheet | Anti PDZD2 pAb (ATL-HPA076072) Datasheet (External Link) |
| Vendor Page | Anti PDZD2 pAb (ATL-HPA076072) |