Anti PDZD2 pAb (ATL-HPA036503)

Atlas Antibodies

Catalog No.:
ATL-HPA036503-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PDZ domain containing 2
Gene Name: PDZD2
Alternative Gene Name: KIAA0300, PDZK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022197: 62%, ENSRNOG00000013140: 63%
Entrez Gene ID: 23037
Uniprot ID: O15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVPEAKASRGGLPSLANGQGIYSVKPLLDTSRNLPATDEGDIISVQETSCLVTDKIKVTRRHYCYEQNWPHESTSFFSVKQRIKSFENLANADRPVAKSG
Gene Sequence VVPEAKASRGGLPSLANGQGIYSVKPLLDTSRNLPATDEGDIISVQETSCLVTDKIKVTRRHYCYEQNWPHESTSFFSVKQRIKSFENLANADRPVAKSG
Gene ID - Mouse ENSMUSG00000022197
Gene ID - Rat ENSRNOG00000013140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDZD2 pAb (ATL-HPA036503)
Datasheet Anti PDZD2 pAb (ATL-HPA036503) Datasheet (External Link)
Vendor Page Anti PDZD2 pAb (ATL-HPA036503) at Atlas Antibodies

Documents & Links for Anti PDZD2 pAb (ATL-HPA036503)
Datasheet Anti PDZD2 pAb (ATL-HPA036503) Datasheet (External Link)
Vendor Page Anti PDZD2 pAb (ATL-HPA036503)