Anti PDXDC1 pAb (ATL-HPA047369)

Atlas Antibodies

Catalog No.:
ATL-HPA047369-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: pyridoxal-dependent decarboxylase domain containing 1
Gene Name: PDXDC1
Alternative Gene Name: KIAA0251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022680: 86%, ENSRNOG00000002407: 80%
Entrez Gene ID: 23042
Uniprot ID: Q6P996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
Gene Sequence PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVSI
Gene ID - Mouse ENSMUSG00000022680
Gene ID - Rat ENSRNOG00000002407
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDXDC1 pAb (ATL-HPA047369)
Datasheet Anti PDXDC1 pAb (ATL-HPA047369) Datasheet (External Link)
Vendor Page Anti PDXDC1 pAb (ATL-HPA047369) at Atlas Antibodies

Documents & Links for Anti PDXDC1 pAb (ATL-HPA047369)
Datasheet Anti PDXDC1 pAb (ATL-HPA047369) Datasheet (External Link)
Vendor Page Anti PDXDC1 pAb (ATL-HPA047369)