Anti PDSS1 pAb (ATL-HPA042741)

Atlas Antibodies

Catalog No.: ATL-HPA042741-25

Protein Description: prenyl (decaprenyl) diphosphate synthase, subunit 1
Gene Name: PDSS1
Alternative Gene Name: COQ1, TPRT, TPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026784: 53%, ENSRNOG00000048849: 57%
Entrez Gene ID: 23590
Uniprot ID: Q5T2R2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELK
• Gene Sequence: SAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELK
• Gene ID - Mouse: ENSMUSG00000026784
• Gene ID - Rat: ENSRNOG00000048849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.