Anti PDRG1 pAb (ATL-HPA063542)

Atlas Antibodies

Catalog No.:
ATL-HPA063542-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: p53 and DNA-damage regulated 1
Gene Name: PDRG1
Alternative Gene Name: C20orf126, dJ310O13.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027472: 94%, ENSRNOG00000008845: 87%
Entrez Gene ID: 81572
Uniprot ID: Q9NUG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLSPEAERVLRYLVEVEELAEEVLADKRQIV
Gene Sequence MLSPEAERVLRYLVEVEELAEEVLADKRQIV
Gene ID - Mouse ENSMUSG00000027472
Gene ID - Rat ENSRNOG00000008845
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDRG1 pAb (ATL-HPA063542)
Datasheet Anti PDRG1 pAb (ATL-HPA063542) Datasheet (External Link)
Vendor Page Anti PDRG1 pAb (ATL-HPA063542) at Atlas Antibodies

Documents & Links for Anti PDRG1 pAb (ATL-HPA063542)
Datasheet Anti PDRG1 pAb (ATL-HPA063542) Datasheet (External Link)
Vendor Page Anti PDRG1 pAb (ATL-HPA063542)