Anti PDPR pAb (ATL-HPA070386)

Atlas Antibodies

Catalog No.:
ATL-HPA070386-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pyruvate dehydrogenase phosphatase regulatory subunit
Gene Name: PDPR
Alternative Gene Name: PDP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033624: 94%, ENSRNOG00000022593: 90%
Entrez Gene ID: 55066
Uniprot ID: Q8NCN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAG
Gene Sequence FEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAG
Gene ID - Mouse ENSMUSG00000033624
Gene ID - Rat ENSRNOG00000022593
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDPR pAb (ATL-HPA070386)
Datasheet Anti PDPR pAb (ATL-HPA070386) Datasheet (External Link)
Vendor Page Anti PDPR pAb (ATL-HPA070386) at Atlas Antibodies

Documents & Links for Anti PDPR pAb (ATL-HPA070386)
Datasheet Anti PDPR pAb (ATL-HPA070386) Datasheet (External Link)
Vendor Page Anti PDPR pAb (ATL-HPA070386)