Anti PDP2 pAb (ATL-HPA062059)

Atlas Antibodies

SKU: ATL-HPA062059-25

• 

Protein Description: pyruvate dehyrogenase phosphatase catalytic subunit 2
Gene Name: PDP2
Alternative Gene Name: KIAA1348, PPM2C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048371: 64%, ENSRNOG00000012343: 67%
Entrez Gene ID: 57546
Uniprot ID: Q9P2J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNS
• Gene Sequence: VPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNS
• Gene ID - Mouse: ENSMUSG00000048371
• Gene ID - Rat: ENSRNOG00000012343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.