Anti PDK4 pAb (ATL-HPA056731)

Atlas Antibodies

SKU: ATL-HPA056731-25

• 

Protein Description: pyruvate dehydrogenase kinase, isozyme 4
Gene Name: PDK4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019577: 93%, ENSRNOG00000009565: 95%
Entrez Gene ID: 5166
Uniprot ID: Q16654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG
• Gene Sequence: QSLMDLVEFHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQG
• Gene ID - Mouse: ENSMUSG00000019577
• Gene ID - Rat: ENSRNOG00000009565
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDK4 pAb (ATL-HPA056731) – 1 Found

Nunes-Xavier, Caroline E; Mingo, Janire; Emaldi, Maite; Flem-Karlsen, Karine; Mælandsmo, Gunhild M; Fodstad, Øystein; Llarena, Roberto; López, José I; Pulido, Rafael. Heterogeneous Expression and Subcellular Localization of Pyruvate Dehydrogenase Complex in Prostate Cancer. Frontiers In Oncology. 12( 35692804):873516.