Anti PDK1 pAb (ATL-HPA027376)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027376-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PDK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006494: 97%, ENSRNOG00000001517: 97%
Entrez Gene ID: 5163
Uniprot ID: Q15118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
| Gene Sequence | KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND |
| Gene ID - Mouse | ENSMUSG00000006494 |
| Gene ID - Rat | ENSRNOG00000001517 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDK1 pAb (ATL-HPA027376) | |
| Datasheet | Anti PDK1 pAb (ATL-HPA027376) Datasheet (External Link) |
| Vendor Page | Anti PDK1 pAb (ATL-HPA027376) at Atlas Antibodies |
| Documents & Links for Anti PDK1 pAb (ATL-HPA027376) | |
| Datasheet | Anti PDK1 pAb (ATL-HPA027376) Datasheet (External Link) |
| Vendor Page | Anti PDK1 pAb (ATL-HPA027376) |
| Citations for Anti PDK1 pAb (ATL-HPA027376) – 3 Found |
| Li, Dandan; Mullinax, John E; Aiken, Taylor; Xin, Hongwu; Wiegand, Gordon; Anderson, Andrew; Thorgeirsson, Snorri; Avital, Itzhak; Rudloff, Udo. Loss of PDPK1 abrogates resistance to gemcitabine in label-retaining pancreatic cancer cells. Bmc Cancer. 2018;18(1):772. PubMed |
| Nunes-Xavier, Caroline E; Mingo, Janire; Emaldi, Maite; Flem-Karlsen, Karine; Mælandsmo, Gunhild M; Fodstad, Øystein; Llarena, Roberto; López, José I; Pulido, Rafael. Heterogeneous Expression and Subcellular Localization of Pyruvate Dehydrogenase Complex in Prostate Cancer. Frontiers In Oncology. 12( 35692804):873516. PubMed |
| Fack, Fred; Espedal, Heidi; Keunen, Olivier; Golebiewska, Anna; Obad, Nina; Harter, Patrick N; Mittelbronn, Michel; Bähr, Oliver; Weyerbrock, Astrid; Stuhr, Linda; Miletic, Hrvoje; Sakariassen, Per Ø; Stieber, Daniel; Rygh, Cecilie B; Lund-Johansen, Morten; Zheng, Liang; Gottlieb, Eyal; Niclou, Simone P; Bjerkvig, Rolf. Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas. Acta Neuropathologica. 2015;129(1):115-31. PubMed |