Anti PDK1 pAb (ATL-HPA027376)

Atlas Antibodies

Catalog No.: ATL-HPA027376-25

Protein Description: pyruvate dehydrogenase kinase, isozyme 1
Gene Name: PDK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006494: 97%, ENSRNOG00000001517: 97%
Entrez Gene ID: 5163
Uniprot ID: Q15118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
• Gene Sequence: KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
• Gene ID - Mouse: ENSMUSG00000006494
• Gene ID - Rat: ENSRNOG00000001517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PDK1 pAb (ATL-HPA027376) – 3 Found

Li, Dandan; Mullinax, John E; Aiken, Taylor; Xin, Hongwu; Wiegand, Gordon; Anderson, Andrew; Thorgeirsson, Snorri; Avital, Itzhak; Rudloff, Udo. Loss of PDPK1 abrogates resistance to gemcitabine in label-retaining pancreatic cancer cells. Bmc Cancer. 2018;18(1):772. 

Nunes-Xavier, Caroline E; Mingo, Janire; Emaldi, Maite; Flem-Karlsen, Karine; Mælandsmo, Gunhild M; Fodstad, Øystein; Llarena, Roberto; López, José I; Pulido, Rafael. Heterogeneous Expression and Subcellular Localization of Pyruvate Dehydrogenase Complex in Prostate Cancer. Frontiers In Oncology. 12( 35692804):873516. 

Fack, Fred; Espedal, Heidi; Keunen, Olivier; Golebiewska, Anna; Obad, Nina; Harter, Patrick N; Mittelbronn, Michel; Bähr, Oliver; Weyerbrock, Astrid; Stuhr, Linda; Miletic, Hrvoje; Sakariassen, Per Ø; Stieber, Daniel; Rygh, Cecilie B; Lund-Johansen, Morten; Zheng, Liang; Gottlieb, Eyal; Niclou, Simone P; Bjerkvig, Rolf. Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas. Acta Neuropathologica. 2015;129(1):115-31.