Anti PDILT pAb (ATL-HPA041913)

Atlas Antibodies

Catalog No.:
ATL-HPA041913-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: protein disulfide isomerase-like, testis expressed
Gene Name: PDILT
Alternative Gene Name: PDIA7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030968: 74%, ENSRNOG00000015368: 72%
Entrez Gene ID: 204474
Uniprot ID: Q8N807
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGI
Gene Sequence VSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGI
Gene ID - Mouse ENSMUSG00000030968
Gene ID - Rat ENSRNOG00000015368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDILT pAb (ATL-HPA041913)
Datasheet Anti PDILT pAb (ATL-HPA041913) Datasheet (External Link)
Vendor Page Anti PDILT pAb (ATL-HPA041913) at Atlas Antibodies

Documents & Links for Anti PDILT pAb (ATL-HPA041913)
Datasheet Anti PDILT pAb (ATL-HPA041913) Datasheet (External Link)
Vendor Page Anti PDILT pAb (ATL-HPA041913)