Anti PDIA4 pAb (ATL-HPA006139)

Atlas Antibodies

Catalog No.: ATL-HPA006139-25

Protein Description: protein disulfide isomerase family A, member 4
Gene Name: PDIA4
Alternative Gene Name: ERP70, ERP72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025823: 96%, ENSRNOG00000006228: 93%
Entrez Gene ID: 9601
Uniprot ID: P13667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD
• Gene Sequence: KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD
• Gene ID - Mouse: ENSMUSG00000025823
• Gene ID - Rat: ENSRNOG00000006228
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.