Anti PDIA4 pAb (ATL-HPA006139)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006139-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PDIA4
Alternative Gene Name: ERP70, ERP72
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025823: 96%, ENSRNOG00000006228: 93%
Entrez Gene ID: 9601
Uniprot ID: P13667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD |
| Gene Sequence | KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD |
| Gene ID - Mouse | ENSMUSG00000025823 |
| Gene ID - Rat | ENSRNOG00000006228 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDIA4 pAb (ATL-HPA006139) | |
| Datasheet | Anti PDIA4 pAb (ATL-HPA006139) Datasheet (External Link) |
| Vendor Page | Anti PDIA4 pAb (ATL-HPA006139) at Atlas Antibodies |
| Documents & Links for Anti PDIA4 pAb (ATL-HPA006139) | |
| Datasheet | Anti PDIA4 pAb (ATL-HPA006139) Datasheet (External Link) |
| Vendor Page | Anti PDIA4 pAb (ATL-HPA006139) |