Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053492-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: protein disulfide isomerase family A, member 2
Gene Name: PDIA2
Alternative Gene Name: PDA2, PDI, PDIP, PDIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024184: 73%, ENSRNOG00000036689: 35%
Entrez Gene ID: 64714
Uniprot ID: Q13087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV
Gene Sequence LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV
Gene ID - Mouse ENSMUSG00000024184
Gene ID - Rat ENSRNOG00000036689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation)
Datasheet Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation)
Datasheet Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDIA2 pAb (ATL-HPA053492 w/enhanced validation)