Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051692-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PDIA2
Alternative Gene Name: PDA2, PDI, PDIP, PDIR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024184: 85%, ENSRNOG00000036689: 37%
Entrez Gene ID: 64714
Uniprot ID: Q13087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYA |
Gene Sequence | RFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYA |
Gene ID - Mouse | ENSMUSG00000024184 |
Gene ID - Rat | ENSRNOG00000036689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) | |
Datasheet | Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) | |
Datasheet | Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) |
Citations for Anti PDIA2 pAb (ATL-HPA051692 w/enhanced validation) – 1 Found |
Guantes, Raul; Rastrojo, Alberto; Neves, Ricardo; Lima, Ana; Aguado, Begoña; Iborra, Francisco J. Global variability in gene expression and alternative splicing is modulated by mitochondrial content. Genome Research. 2015;25(5):633-44. PubMed |