Anti PDHB pAb (ATL-HPA036745 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036745-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pyruvate dehydrogenase (lipoamide) beta
Gene Name: PDHB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021748: 92%, ENSRNOG00000007895: 91%
Entrez Gene ID: 5162
Uniprot ID: P11177
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE
Gene Sequence LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE
Gene ID - Mouse ENSMUSG00000021748
Gene ID - Rat ENSRNOG00000007895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDHB pAb (ATL-HPA036745 w/enhanced validation)
Datasheet Anti PDHB pAb (ATL-HPA036745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDHB pAb (ATL-HPA036745 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PDHB pAb (ATL-HPA036745 w/enhanced validation)
Datasheet Anti PDHB pAb (ATL-HPA036745 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PDHB pAb (ATL-HPA036745 w/enhanced validation)