Anti PDHA2 pAb (ATL-HPA047487)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047487-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: PDHA2
Alternative Gene Name: PDHAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031299: 97%, ENSRNOG00000025383: 97%
Entrez Gene ID: 5161
Uniprot ID: P29803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG |
| Gene Sequence | ILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVG |
| Gene ID - Mouse | ENSMUSG00000031299 |
| Gene ID - Rat | ENSRNOG00000025383 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PDHA2 pAb (ATL-HPA047487) | |
| Datasheet | Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link) |
| Vendor Page | Anti PDHA2 pAb (ATL-HPA047487) at Atlas Antibodies |
| Documents & Links for Anti PDHA2 pAb (ATL-HPA047487) | |
| Datasheet | Anti PDHA2 pAb (ATL-HPA047487) Datasheet (External Link) |
| Vendor Page | Anti PDHA2 pAb (ATL-HPA047487) |