Anti PDGFC pAb (ATL-HPA009134)

Atlas Antibodies

Catalog No.: ATL-HPA009134-25

Protein Description: platelet derived growth factor C
Gene Name: PDGFC
Alternative Gene Name: fallotein, SCDGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028019: 60%, ENSRNOG00000010695: 55%
Entrez Gene ID: 56034
Uniprot ID: Q9NRA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA
• Gene Sequence: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA
• Gene ID - Mouse: ENSMUSG00000028019
• Gene ID - Rat: ENSRNOG00000010695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.