Anti PDGFC pAb (ATL-HPA009134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009134-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PDGFC
Alternative Gene Name: fallotein, SCDGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028019: 60%, ENSRNOG00000010695: 55%
Entrez Gene ID: 56034
Uniprot ID: Q9NRA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA |
Gene Sequence | LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA |
Gene ID - Mouse | ENSMUSG00000028019 |
Gene ID - Rat | ENSRNOG00000010695 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PDGFC pAb (ATL-HPA009134) | |
Datasheet | Anti PDGFC pAb (ATL-HPA009134) Datasheet (External Link) |
Vendor Page | Anti PDGFC pAb (ATL-HPA009134) at Atlas Antibodies |
Documents & Links for Anti PDGFC pAb (ATL-HPA009134) | |
Datasheet | Anti PDGFC pAb (ATL-HPA009134) Datasheet (External Link) |
Vendor Page | Anti PDGFC pAb (ATL-HPA009134) |