Anti PDE8A pAb (ATL-HPA007722)

Atlas Antibodies

Catalog No.:
ATL-HPA007722-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphodiesterase 8A
Gene Name: PDE8A
Alternative Gene Name: HsT19550
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025584: 79%, ENSRNOG00000019005: 80%
Entrez Gene ID: 5151
Uniprot ID: O60658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEVSSQRRHSS
Gene Sequence TTMGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEVSSQRRHSS
Gene ID - Mouse ENSMUSG00000025584
Gene ID - Rat ENSRNOG00000019005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PDE8A pAb (ATL-HPA007722)
Datasheet Anti PDE8A pAb (ATL-HPA007722) Datasheet (External Link)
Vendor Page Anti PDE8A pAb (ATL-HPA007722) at Atlas Antibodies

Documents & Links for Anti PDE8A pAb (ATL-HPA007722)
Datasheet Anti PDE8A pAb (ATL-HPA007722) Datasheet (External Link)
Vendor Page Anti PDE8A pAb (ATL-HPA007722)
Citations for Anti PDE8A pAb (ATL-HPA007722) – 3 Found
Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.  PubMed
Carvalho, Thays Maria da Conceição Silva; Cardarelli, Silvia; Giorgi, Mauro; Lenzi, Andrea; Isidori, Andrea M; Naro, Fabio. Phosphodiesterases Expression during Murine Cardiac Development. International Journal Of Molecular Sciences. 2021;22(5)  PubMed
Campolo, Federica; Capponi, Chiara; Tarsitano, Maria Grazia; Tenuta, Marta; Pozza, Carlotta; Gianfrilli, Daniele; Magliocca, Fabio; Venneri, Mary A; Vicini, Elena; Lenzi, Andrea; Isidori, Andrea M; Barbagallo, Federica. cAMP-specific phosphodiesterase 8A and 8B isoforms are differentially expressed in human testis and Leydig cell tumor. Frontiers In Endocrinology. 13( 36277728):1010924.  PubMed